Germany
Japan
United Kingdom
China
Rabbit anti-ABHD6 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ABHD6. |
Antibodies
View as table Download
ABHD6 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ABHD6 |
Rabbit Polyclonal Anti-ABHD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABHD6 antibody is: synthetic peptide directed towards the C-terminal region of Human ABHD6. Synthetic peptide located within the following region: MLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD |
ABHD6 Rabbit polyclonal Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ABHD6