Antibodies

View as table Download

Rabbit Polyclonal Anti-ACAA1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD

Carrier-free (BSA/glycerol-free) ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ACAA1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-300 of human ACAA1 (NP_001598.1).
Modifications Unmodified

ACAA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-300 of human ACAA1 (NP_001598.1).
Modifications Unmodified

ACAA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-300 of human ACAA1 (NP_001598.1).
Modifications Unmodified

ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated