Rabbit Polyclonal Anti-ACBD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACBD4 antibody: synthetic peptide directed towards the N terminal of human ACBD4. Synthetic peptide located within the following region: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT |
Rabbit Polyclonal Anti-ACBD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACBD4 antibody: synthetic peptide directed towards the N terminal of human ACBD4. Synthetic peptide located within the following region: NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI |
ACBD4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
