Rabbit Polyclonal Anti-PHACS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHACS antibody: synthetic peptide directed towards the middle region of human PHACS. Synthetic peptide located within the following region: RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC |
ACCS Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 222-501 of human ACCS (NP_115981.1). |
| Modifications | Unmodified |
ACCS Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 222-501 of human ACCS (NP_115981.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China