Rabbit polyclonal anti-ASAH3L antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ASAH3L. |
Rabbit polyclonal anti-ASAH3L antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ASAH3L. |
Rabbit Polyclonal Anti-ACER2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACER2 antibody is: synthetic peptide directed towards the middle region of Human ACER2. Synthetic peptide located within the following region: DELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVTTCLAFV |
ASAH3L Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthesized peptide derived from ASAH3L . at AA range: 50-130 |