Antibodies

View as table Download

ACRV1 mouse monoclonal antibody, clone Ds-2, Purified

Applications IF, WB
Reactivities Canine

Rabbit Polyclonal Anti-ACRV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACRV1 Antibody: synthetic peptide directed towards the N terminal of human ACRV1. Synthetic peptide located within the following region: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS

ACRV1 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-265 of human ACRV1 (NP_001603.1).
Modifications Unmodified