Antibodies

Jump to Filters
View as table Download
ACRV1 Mouse Monoclonal Antibody [Clone ID: Ds-2]
SM3096P

USD 250.00

2 Weeks

ACRV1 mouse monoclonal antibody, clone Ds-2, Purified

Applications IF, WB
Reactivities Canine
ACRV1 Rabbit Polyclonal Antibody
TA335863

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACRV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACRV1 Antibody: synthetic peptide directed towards the N terminal of human ACRV1. Synthetic peptide located within the following region: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS
ACRV1 Rabbit Polyclonal Antibody
TA373209

USD 275.00

3 Weeks

ACRV1 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-265 of human ACRV1 (NP_001603.1).
Modifications Unmodified