Antibodies

View as table Download

Rabbit anti-ACTL6A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACTL6A

Rabbit polyclonal anti-ACL6A antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACL6A.

Rabbit Polyclonal Anti-ACTL6A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTL6A antibody is: synthetic peptide directed towards the middle region of Human ACTL6A. Synthetic peptide located within the following region: TVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSV

Rabbit Polyclonal Anti-ACTL6A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTL6A Antibody: synthetic peptide directed towards the N terminal of human ACTL6A. Synthetic peptide located within the following region: VDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEA

ACTL6A Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human ACTL6A