Germany
Japan
United Kingdom
China
Rabbit anti-ACTL6A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACTL6A |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTL6A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTL6A antibody is: synthetic peptide directed towards the middle region of Human ACTL6A. Synthetic peptide located within the following region: TVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSV |
Rabbit Polyclonal Anti-ACTL6A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTL6A Antibody: synthetic peptide directed towards the N terminal of human ACTL6A. Synthetic peptide located within the following region: VDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEA |
ACTL6A Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human ACTL6A |
Active filters
Target Symbol
- ACTL6A