ACTR3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACTR3 |
ACTR3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACTR3 |
Rabbit polyclonal anti-ACTR3 antibody
Applications | WB |
Reactivities | Human Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ACTR3. |
Arp3 (ACTR3) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human ACTR3 |
Anti-ACTR3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 210 amino acids of human ARP3 actin-related protein 3 homolog (yeast) |
Rabbit Polyclonal Anti-ACTR3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTR3 antibody: synthetic peptide directed towards the N terminal of human ACTR3. Synthetic peptide located within the following region: IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE |
Carrier-free (BSA/glycerol-free) ACTR3 mouse monoclonal antibody,clone OTI2B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACTR3 mouse monoclonal antibody,clone OTI5G4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ACTR3 Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ACTR3 |
ACTR3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human ACTR3 |
Actin Related Protein 3 Rabbit monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ACTR3 mouse monoclonal antibody,clone OTI2B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ACTR3 mouse monoclonal antibody,clone OTI2B9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ACTR3 mouse monoclonal antibody,clone OTI2B9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ACTR3 mouse monoclonal antibody,clone OTI2B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ACTR3 mouse monoclonal antibody,clone OTI5G4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ACTR3 mouse monoclonal antibody,clone OTI5G4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ACTR3 mouse monoclonal antibody,clone OTI5G4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ACTR3 mouse monoclonal antibody,clone OTI5G4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |