Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ADAM12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAM12 antibody: synthetic peptide directed towards the N terminal of human ADAM12. Synthetic peptide located within the following region: VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE |
Goat Polyclonal Antibody against ADAM12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AARPLPVSPARALC, from the N Terminus of the protein sequence according to NP_003465; NP_067673. |
Goat Anti-ADAM12 (aa225-239) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-REFQRQGKDLEKVKQ, from the internal region of the protein sequence according to NP_003465.3; NP_067673.2. |
Rabbit polyclonal anti-ADAM12 antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ADAM12 |
Anti-ADAM12 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 223-239 amino acids of human ADAM metallopeptidase domain 12 |
ADAM12 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 589-738 of human ADAM12 (NP_067673.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ADAM12