Rabbit Polyclonal Anti-ADAM15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAM15 antibody: synthetic peptide directed towards the middle region of human ADAM15. Synthetic peptide located within the following region: QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ |
Rabbit anti-ADAM15 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit polyclonal anti-ADAM15 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADAM15 |
Rabbit polyclonal anti-ADAM15 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | ADAM15 |
Rabbit polyclonal anti-ADAM15 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADAM15 |
Rabbit polyclonal anti-ADAM15 antibody
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | ADAM15 |
Anti-ADAM15 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 213-414 amino acids of human ADAM metallopeptidase domain 15 |
ADAM15 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ADAM15 |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
