Antibodies

View as table Download

Goat Polyclonal Antibody against ADAM33

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQSRRCRKNAFQEL, from the internal region of the protein sequence according to NP_079496.1.

Rabbit Polyclonal Anti-ADAM33 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAM33 antibody: synthetic peptide directed towards the middle region of human ADAM33. Synthetic peptide located within the following region: HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA

ADAM33 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human ADAM33 (NP_001269376.1).
Modifications Unmodified