Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti CD156b (IN) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the human CD156b at extracellular domain. This sequence is identical among human, mouse or rat origins. |
Goat Polyclonal Antibody against ADAM8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QRKQGAGAPTAP, from the C Terminus of the protein sequence according to NP_001100. |
Rabbit Polyclonal Anti-ADAM8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAM8 antibody: synthetic peptide directed towards the N terminal of human ADAM8. Synthetic peptide located within the following region: LHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAA |
Rabbit anti CD156b (NT) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the human CD156b at Pro- domain. This sequence is identical among human, mouse and/or rat origins. |
Rabbit anti CD156b Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the human CD156b at Pro- domain. This sequence is identical among human, mouse and/or rat origins. |
ADAM8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse ADAM8 |
ADAM8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 17-300 of human ADAM8 (NP_001100.3). |
| Modifications | Unmodified |
ADAM8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 17-300 of human ADAM8 (NP_001100.3). |
| Modifications | Unmodified |
MS2 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ADAM8