Antibodies

View as table Download

ADAMDEC1 (N-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 47~76 amino acids from the N-terminal region of human ADAMDEC1

Rabbit polyclonal anti-ADAMDEC1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADAMDEC1.

Rabbit Polyclonal Anti-ADAMDEC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAMDEC1 antibody: synthetic peptide directed towards the middle region of human ADAMDEC1. Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL

Anti-ADAMDEC1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 206-340 amino acids of human ADAM-like, decysin 1

Anti-ADAMDEC1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 206-340 amino acids of human ADAM-like, decysin 1

ADAMDEC1 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified