Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against CENTA1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QEYAVEAHFKHKP, from the C Terminus of the protein sequence according to NP_006860. |
Rabbit Polyclonal Anti-Adap1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Centa1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ARFHYLQVAFPGASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTM |
Anti-ADAP1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 3-376 amino acids of human Arf-GAP with dual PH domain-containing protein 1 |
ADAP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ADAP1 |
ADAP1 Rabbit polyclonal Antibody
| Applications | ELISA, ICC/IF, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- ADAP1