Antibodies

View as table Download

Rabbit polyclonal anti-ADCK2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCK2.

Rabbit Polyclonal Anti-ADCK2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCK2 antibody is: synthetic peptide directed towards the middle region of Human ADCK2. Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI

ADCK2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated