Rabbit Polyclonal Anti-ADD3 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADD3 antibody: synthetic peptide directed towards the C terminal of human ADD3. Synthetic peptide located within the following region: DELAKRVSRLSTSTTIENIEITIKSPEKIEEVLSPEGSPSKSPSKKKKKF |
Rabbit polyclonal anti-ADD3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADD3. |
Rabbit Polyclonal Anti-ADD3 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADD3 antibody: synthetic peptide directed towards the middle region of human ADD3. Synthetic peptide located within the following region: AYYDYQGSLEEQEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYI |
ADD3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human ADD3 (NP_001307523.1). |
Germany
Japan
United Kingdom
China
