Antibodies

Jump to Filters
View as table Download
GPR115 (ADGRF4) Rabbit Polyclonal Antibody
TA316254

USD 345.00

In Stock

Rabbit polyclonal anti-GPR115 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR115.
GPR115 (ADGRF4) Rabbit Polyclonal Antibody
TA316253

USD 345.00

4 Weeks

Rabbit polyclonal anti-GPR115 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GPR115.
GPR115 (ADGRF4) Rabbit Polyclonal Antibody
TA331606

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPR115 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR115 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR115. Synthetic peptide located within the following region: SQATMICCLVFFLSTECSHYRSKIHLKAGDKLQSPEGKPKTGRIQEKCEG
GPR115 (ADGRF4) Rabbit Polyclonal Antibody
TA340648

USD 425.00

5 Days

Rabbit Polyclonal Anti-GPR115 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR115 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPR115. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Bovine, Horse (100%); Elephant, Dog, Rabbit (94%).