Antibodies

Jump to Filters
View as table Download
Adgrl1 Rabbit Polyclonal Antibody
TA328869

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Latrophilin-1 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CEPREVRRVQWPATQ(G), corresponding to amino acid residues 480-494 of rat Latrophilin-1. Extracellular, N-terminus.
LPHN1 (ADGRL1) Rabbit Polyclonal Antibody
TA315194

USD 345.00

4 Weeks

Rabbit polyclonal anti-LPHN1 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LPHN1.
LPHN1 (ADGRL1) Rabbit Polyclonal Antibody
TA338344

USD 375.00

5 Days

Rabbit Polyclonal Anti-LPHN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LPHN1 antibody is: synthetic peptide directed towards the C-terminal region of Human LPHN1. Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK