Rabbit anti ADM2 Polyclonal Antibody
| Conjugation | Unconjugated |
Rabbit anti ADM2 Polyclonal Antibody
| Conjugation | Unconjugated |
Rabbit polyclonal anti Intermedin (rt); neat antiserum
| Applications | ELISA |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti Intermedin (rt); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ADM2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ADM2 |
ADM2 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS |
ADM2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ADM2 |