Antibodies

View as table Download

Rabbit anti ADM2 Polyclonal Antibody

Conjugation Unconjugated

Rabbit polyclonal anti Intermedin (rt); neat antiserum

Applications ELISA
Reactivities Rat
Conjugation Unconjugated

Rabbit polyclonal anti Intermedin (rt); purified rabbit IgG

Applications ELISA
Reactivities Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ADM2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADM2

ADM2 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS

ADM2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADM2