Rabbit anti ADM2 Polyclonal Antibody
Conjugation | Unconjugated |
Rabbit anti ADM2 Polyclonal Antibody
Conjugation | Unconjugated |
Rabbit polyclonal anti Intermedin (rt); neat antiserum
Applications | ELISA |
Reactivities | Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti Intermedin (rt); purified rabbit IgG
Applications | ELISA |
Reactivities | Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ADM2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ADM2 |
ADM2 Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS |
ADM2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ADM2 |