Antibodies

View as table Download

Rabbit Polyclonal Anti-ADPRHL2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADPRHL2

ARH3 (ADPRHL2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 93~123 amino acids from the N-terminal region of human ADPRHL2

Rabbit Polyclonal Anti-ADPRHL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADPRHL2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADPRHL2. Synthetic peptide located within the following region: SVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESV