Germany
Japan
United Kingdom
China
Antibodies
View as table Download
beta 2 Adrenergic Receptor (ADRB2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 311-360 of Human AR-β2. |
Rabbit Polyclonal Adrenergic Receptor beta2 (Ser346) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human:S346 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2 around the phosphorylation site of Serine 346 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ADRB2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADRB2 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human ADRB2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (88%); Mouse (81%). |
Goat Polyclonal Antibody against ADRB2
| Applications | WB |
| Reactivities | Human, Cow |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQGTVPSDNIDSQ, from the C Terminus of the protein sequence according to NP_000015.1. |
ADRB2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ADRB2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Monkey, Marmoset (94%). |
Rabbit Polyclonal Adrenergic Receptor beta2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2 |
Rabbit Polyclonal Anti-ADRB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRB2 antibody: synthetic peptide directed towards the middle region of human ADRB2. Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN |
Rabbit Polyclonal Anti-ADRB2 Antibody (Transmembrane Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ADRB2 antibody was raised against synthetic 16 amino acid peptide from 5th transmembrane domain of human ADRB2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%); Pufferfish, Zebrafish, Stickleback (94%); Marmoset, Mouse, Rat, Hamster (88%); Bovine, Dog, Cat, Elephant, Pig, Guinea pig, Xenopus (81%). |
Anti-ADRB2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 21-33 amino acids of human adrenoceptor beta 2, surface |
ADRB2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 334-413 of human ADRB2 (NP_000015.1). |
| Modifications | Unmodified |
USD 523.00
2 Weeks
Recombinant Anti-Beta 2 adrenergic receptor (Clone R11/E1)
| Applications | FC, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 523.00
2 Weeks
Recombinant Anti-Beta 2 adrenergic receptor (Clone R11/E1)
| Applications | FC, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
USD 523.00
2 Weeks
Recombinant Anti-Beta 2 adrenergic receptor (Clone 13D6)
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 523.00
2 Weeks
Recombinant Anti-Beta 2 adrenergic receptor (Clone 13D6)
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- ADRB2