Antibodies

View as table Download

ADRB2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADRB2

Rabbit polyclonal anti-ADRB2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADRB2.

beta 2 Adrenergic Receptor (ADRB2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 311-360 of Human AR-β2.

Rabbit Polyclonal Adrenergic Receptor beta2 (Ser346) Antibody (Phospho-specific)

Applications WB
Reactivities Human:S346
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2 around the phosphorylation site of Serine 346
Modifications Phospho-specific

Rabbit polyclonal anti-ADRB2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ADRB2.

Rabbit Polyclonal Anti-beta2-Adrenoceptor (extracellular)

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NGSRAPDHDVTQERDE, corresponding to amino acid residues 15-30 of mouse Ã?2-Adrenoceptor. Extracellular, N-terminus.

Rabbit Polyclonal Anti-ADRB2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ADRB2 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human ADRB2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (88%); Mouse (81%).

Goat Polyclonal Antibody against ADRB2

Applications WB
Reactivities Human, Cow
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQGTVPSDNIDSQ, from the C Terminus of the protein sequence according to NP_000015.1.

ADRB2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human
Conjugation Unconjugated
Immunogen ADRB2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Monkey, Marmoset (94%).

Rabbit Polyclonal Adrenergic Receptor beta2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2

Rabbit Polyclonal Anti-ADRB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB2 antibody: synthetic peptide directed towards the middle region of human ADRB2. Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN

Rabbit Polyclonal Anti-ADRB2 Antibody (Transmembrane Domain)

Applications IHC
Reactivities Human
Immunogen ADRB2 antibody was raised against synthetic 16 amino acid peptide from 5th transmembrane domain of human ADRB2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%); Pufferfish, Zebrafish, Stickleback (94%); Marmoset, Mouse, Rat, Hamster (88%); Bovine, Dog, Cat, Elephant, Pig, Guinea pig, Xenopus (81%).

Anti-ADRB2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 21-33 amino acids of human adrenoceptor beta 2, surface

Anti-ADRB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface

ADRB2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADRB2

ADRB2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 334-413 of human ADRB2 (NP_000015.1).
Modifications Unmodified

Recombinant Anti-Beta 2 adrenergic receptor (Clone R11/E1)

Applications FC, IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-Beta 2 adrenergic receptor (Clone 13D6)

Applications ELISA, IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.