Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ADAM29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADAM29 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADAM29. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ADRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRM1 antibody: synthetic peptide directed towards the C terminal of human ADRM1. Synthetic peptide located within the following region: QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDE |
Rabbit Polyclonal Anti-ADRM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRM1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADRM1. Synthetic peptide located within the following region: PSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALG |
ADRM1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1 |
ADRM1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1 |
ADRM1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ADRM1 |
Active filters
Target Symbol
- ADRM1