Rabbit Polyclonal Anti-AFF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AFF2 antibody: synthetic peptide directed towards the middle region of human AFF2. Synthetic peptide located within the following region: AMGNCNNGPVTIPQRIHHMAASHVNITSNVLRGYEHWDMADKLTRENKEF |
Rabbit Polyclonal Anti-AFF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AFF2 Antibody: synthetic peptide directed towards the N terminal of human AFF2. Synthetic peptide located within the following region: MDLFDFFRDWDLEQQCHYEQDRSALKKREWERRNQEVQQEDDLFSSGFDL |
Anti-AFF2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-17 amino acids of human AF4/FMR2 family, member 2 |
Germany
Japan
United Kingdom
China
