Rabbit Polyclonal Anti-AGER Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the N terminal of human AGER. Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT |
Rabbit Polyclonal Anti-AGER Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: PSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPG |
Rabbit Polyclonal Anti-AGER Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: RIRAGNSSPGPGDPGRPGDSRPAHWGHLVAKAATPRRGEEGPRKPGGRGG |
Rabbit anti-AGER Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AGER |
RAGE (AGER) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence mapping in the middle region of Human advanced glycosylation end-product-specific receptor(RAGE), different from the related Mouse and Rat sequences by two amino acids. |
Rabbit polyclonal AGER Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AGER antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human AGER. |
Rabbit polyclonal RAGE (AGER) Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAGE (AGER) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 348-378 amino acids from the C-terminal region of human RAGE (AGER). |
AGER rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AGER |
AGER Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 41-340 of human AGER (NP_001127.1). |
| Modifications | Unmodified |
Recombinant Anti-RAGE (Clone 2A11)
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-RAGE (Clone 2A11)
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China
