Rabbit Polyclonal Anti-AHI1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ahi1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYV |
Rabbit Polyclonal antibody to AHI1 (Abelson helper integration site 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 42 of AHI1 (Uniprot ID#Q8N157) |
Rabbit Polyclonal Anti-AHI1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AHI1 |
Germany
Japan
United Kingdom
China