Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-AHSG Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHSG |
Goat Polyclonal Anti-AHSG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_001613.2 (QPEGANEAVPTP) |
Goat polyclonal anti-Fetuin antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from rabbit serum after repeated immunizations with a recombinant human fetuin (a2-HS glycoprotein) processed to remove a 40 amino acid residue bridging peptide resulting in the mature form of the protein. |
Rabbit Polyclonal Anti-AHSG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AHSG antibody: synthetic peptide directed towards the N terminal of human AHSG. Synthetic peptide located within the following region: AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL |
Rabbit Polyclonal Anti-AHSG Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AHSG |
AHSG rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AHSG |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- AHSG