Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal AIFM3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AIFM3 antibody was raised against a 16 amino acid peptide from near the center of human AIFM3. |
Rabbit Polyclonal Anti-AIFM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AIFM3 antibody: synthetic peptide directed towards the middle region of human AIFM3. Synthetic peptide located within the following region: EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL |
Rabbit Polyclonal Anti-AIFM3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AIFM3 |
AIFM3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AIFM3 |
AIFM3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human AIFM3 (NP_001018070.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- AIFM3