Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal AKAP95/AKAP8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH-conjugated human AKAP95 peptide within amino acids 650 to 692 [Swiss-Prot# O43823]. |
Rabbit Polyclonal Anti-AKAP8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKAP8 Antibody: A synthesized peptide derived from human AKAP8 |
Goat Polyclonal Antibody against AKAP8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DQGYGGYGAWSAG-C, from the N Terminus of the protein sequence according to NP_005849. |
Rabbit Polyclonal anti-AKAP8 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKAP8 antibody: synthetic peptide directed towards the middle region of human AKAP8. Synthetic peptide located within the following region: DVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLL |
Rabbit Polyclonal Anti-AKAP8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKAP8 antibody: synthetic peptide directed towards the middle region of human AKAP8. Synthetic peptide located within the following region: YLKGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRA |
Rabbit Polyclonal Anti-AKAP8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKAP8 antibody: synthetic peptide directed towards the middle region of human AKAP8. Synthetic peptide located within the following region: CKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKI |
Anti-AKAP8 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 679-691 amino acids of human A kinase (PRKA) anchor protein 8 |
AKAP8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AKAP8 |
AKAP8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AKAP8 |
AKAP8 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKAP8 |
| Modifications | Unmodified |
AKAP8 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 480-692 of human AKAP8 (NP_005849.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- AKAP8