Germany
Japan
United Kingdom
China
AKR1B1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AKR1B1 |
Antibodies
View as table Download
Rabbit polyclonal AKR1B1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AKR1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 290-316 amino acids from the C-terminal region of human AKR1B1. |
Rabbit Polyclonal Anti-AKR1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the N terminal of human AKR1B1. Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN |
Rabbit Polyclonal Anti-AKR1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the C terminal of human AKR1B1. Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI |
Rabbit polyclonal anti-AKR1B1 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AKR1B1. |
Mouse Monoclonal AKR1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal AKR1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-AKR1B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-AKR1B1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase) |
Anti-AKR1B1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase) |
AKR1B1 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse AKR1B1 |
AKR1B1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-316 of human AKR1B1 (NP_001619.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- AKR1B1