Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-AKT1S1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKT1S1 antibody: synthetic peptide directed towards the C terminal of human AKT1S1. Synthetic peptide located within the following region: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE |
Rabbit Polyclonal Anti-Akt1s1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Akt1s1 antibody is: synthetic peptide directed towards the middle region of Rat Akt1s1. Synthetic peptide located within the following region: DEEDEDEPTETETSGERLGGSDNGGLFMMDEDATLQDLPPFCESDPESTD |
Rabbit polyclonal AKT1S1 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AKT1S1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-256 amino acids from the C-terminal region of human AKT1S1. |
Phospho-AKT1S1/PRAS40-T246 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | Phospho T246 |
PRAS40 (phospho-T246) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human PRAS40 around the phosphorylation site of Threonine 246. |
Active filters
Target Symbol
- AKT1S1