Antibodies

View as table Download

Rabbit Polyclonal Anti-ALDOC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the N terminal of human ALDOC. Synthetic peptide located within the following region: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE

Rabbit Polyclonal Anti-ALDOC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the C terminal of human ALDOC. Synthetic peptide located within the following region: CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA

Aldolase C (ALDOC) (C-term) rabbit polyclonal antibody, Ig Fraction

Applications IHC, WB
Reactivities Human
Immunogen ALDOC antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of Human ALDOC.
Epitope: C-Terminus

Aldolase C (ALDOC) (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human ALDOC.

Mouse monoclonal ALDOC Antibody (C-term)(Ascites)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

ALDOC Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified