Rabbit Polyclonal Anti-ALOX15B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the C terminal of human ALOX15B. Synthetic peptide located within the following region: ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR |
Rabbit Polyclonal Anti-ALOX15B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the N terminal of human ALOX15B. Synthetic peptide located within the following region: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE |
Rabbit Polyclonal Anti-ALOX15B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the middle region of human ALOX15B. Synthetic peptide located within the following region: CHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVI |
Rabbit Polyclonal Anti-ALOX15B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the middle region of human ALOX15B. Synthetic peptide located within the following region: LLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGFSELIQRNMKQLN |
Rabbit anti 15-Lox-2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ALOX15B Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ALOX15B (NP_001132.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
