Antibodies

Jump to Filters
View as table Download
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA346268

USD 410.00

5 Days

Rabbit Polyclonal Anti-ALOX15B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the C terminal of human ALOX15B. Synthetic peptide located within the following region: ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA346267

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALOX15B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the N terminal of human ALOX15B. Synthetic peptide located within the following region: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA346276

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALOX15B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the middle region of human ALOX15B. Synthetic peptide located within the following region: CHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVI
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA346277

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALOX15B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the middle region of human ALOX15B. Synthetic peptide located within the following region: LLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGFSELIQRNMKQLN
15 Lipoxygenase 2 (ALOX15B) (C-term) Rabbit Polyclonal Antibody
AP50153PU-N

USD 512.00

2 Weeks

15 Lipoxygenase 2 (ALOX15B) (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 605~634 amino acids from the C-terminal region of human ALOX15B
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA354514

USD 325.00

5 Days

Rabbit anti 15-Lox-2 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA323365

USD 345.00

In Stock

Anti-ALOX15B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 30-351 amino acids of human arachidonate 15-lipoxygenase, type B
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA373468

USD 410.00

3 Weeks

ALOX15B Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified