Antibodies

View as table Download

Rabbit Polyclonal Anti-ALPP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALPP antibody: synthetic peptide directed towards the C terminal of human ALPP. Synthetic peptide located within the following region: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA

Rabbit polyclonal antibody to Alkaline phosphatase(placental ) (alkaline phosphatase, placental (Regan isozyme))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 163 and 387 of Placental Alkaline Phosphatase (Uniprot ID#P05187)

Alkaline Phosphatase (ALPP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 55-83 amino acids from the N-terminal region of human ALPP

Rabbit anti PLAP Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ALPP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALPP

Placental Alkaline Phosphatase Mouse Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

ALPP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALPP

Placental alkaline phosphatase (PLAP) Rabbit polyclonal Antibody

Applications ELISA, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified

Placental Alkaline Phosphatase Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Placental alkaline phosphatase (PLAP)

Placental Alkaline Phosphatase Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the N-terminal region of human ALPP/ALPPL2. AA range:1-50