Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-AMACR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP |
Rabbit anti-AMACR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AMACR |
Goat Anti-AMACR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLNSDKIIESN, from the C Terminus of the protein sequence according to NP_055139.4; NP_001161067.1 |
Goat Anti-AMACR (aa312-326) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RGSFITSEEQDVSPR, from the internal region of the protein sequence according to NP_055139.4; NP_001161067.1 |
Rabbit anti AMACR Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI4G5 (formerly 4G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Alpha-Methylacyl-CoA Racemase (AMACR, p504s) Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
AMACR rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AMACR |
USD 420.00
5 Days
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI4G5 (formerly 4G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
AMACR mouse monoclonal antibody,clone 4G5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
AMACR mouse monoclonal antibody,clone 4G5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI4G5 (formerly 4G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
USD 420.00
4 Weeks
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Active filters
Target Symbol
- AMACR