Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-Alpha-Amylase antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 492 of human a-Amylase. |
Antibodies
View as table Download
Rabbit polyclonal anti-Alpha-Amylase antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 273 of rat a-Amylase |
Rabbit Polyclonal Anti-Amy1a Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Immunogen | The immunogen for anti-Amy1a antibody is: synthetic peptide directed towards the middle region of Rat Amy1a. Synthetic peptide located within the following region: YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV |
AMY1A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AMY1A |
AMY1A Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
AMY1A Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- AMY1A