Antibodies

Jump to Filters
View as table Download
Angiopoietin 4 (ANGPT4) Rabbit Polyclonal Antibody
TA345083

USD 475.00

5 Days

Rabbit Polyclonal Anti-ANGPT4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANGPT4 antibody: synthetic peptide directed towards the N terminal of human ANGPT4. Synthetic peptide located within the following region: TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT
Angiopoietin 4 (ANGPT4) Rabbit Polyclonal Antibody
TA350852

USD 345.00

In Stock

Rabbit Polyclonal Anti-ANGPT4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANGPT4
Angiopoietin 4 (ANGPT4) Rabbit Polyclonal Antibody
TA373509

USD 410.00

3 Weeks

ANGPT4 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified