Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-ANK1 antibody for SISCAPA, clone OTIR3A12
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ANK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANK1 antibody: synthetic peptide directed towards the C terminal of human ANK1. Synthetic peptide located within the following region: VVRQIDLSSADAAQEHEEVELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ |
Rabbit Polyclonal Anti-ANK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANK1 antibody: synthetic peptide directed towards the middle region of human ANK1. Synthetic peptide located within the following region: PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG |
Active filters
Target Symbol
- ANK1