Germany
Japan
United Kingdom
China
Chicken Polyclonal ANKLE2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ANKLE2 antibody was raised against a 19 amino acid synthetic peptide near the center of human ANKLE2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ANKLE2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ANKLE2 Antibody: synthetic peptide directed towards the middle region of human ANKLE2. Synthetic peptide located within the following region: CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG |
ANKLE2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human ANKLE2 (NP_055929.1). |
| Modifications | Unmodified |
ANKLE2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human ANKLE2 (NP_055929.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ANKLE2