Rabbit Polyclonal Anti-ANKRD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANKRD2 antibody: synthetic peptide directed towards the N terminal of human ANKRD2. Synthetic peptide located within the following region: QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL |
ANKRD2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKRD2 |
ANKRD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-140 of human ANKRD2 (NP_001123453.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China