Antibodies

Jump to Filters
View as table Download
ANKRD39 Rabbit Polyclonal Antibody
TA345024

USD 475.00

5 Days

Rabbit Polyclonal Anti-ANKRD39 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANKRD39 antibody: synthetic peptide directed towards the N terminal of human ANKRD39. Synthetic peptide located within the following region: IWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLL
ANKRD39 (C-term) Rabbit Polyclonal Antibody
AP50194PU-N

USD 450.00

2 Weeks

ANKRD39 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 144-172 amino acids from the C-terminal region of human ANR39