Antibodies

View as table Download

Rabbit Polyclonal Anti-Ano6 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ano6 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE

Rabbit polyclonal ANO6 Antibody (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ANO6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 68-96 amino acids from the N-terminal region of human ANO6.

Rabbit Polyclonal Anti-ANO6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ANO6 Antibody: synthetic peptide directed towards the C-terminal region of human ANO6. Synthetic peptide located within the following region: KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV

ANO6 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified