Rabbit monoclonal antibody against CD13(clone EPR4058)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal antibody against CD13(clone EPR4058)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 880-930 of Human CD13. |
Rabbit anti-ANPEP Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CD13 (dendritic cells, aminopeptidase), rat anti mouse, clone ER-BMDM1
| Applications | IHC |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, Biotin
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | Biotin |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free
| Applications | FC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified
| Applications | FC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | APC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | PE |
Mouse Anti-Human CD13 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ANPEP |
CD13 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD13 mouse monoclonal antibody,clone UMAB275
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD13 mouse monoclonal antibody,clone UMAB275
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD13 mouse monoclonal antibody,clone UMAB275
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |