Antibodies

View as table Download

ANTXR2 (121-133) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rabbit
Immunogen Synthetic peptide from an internal region of human ANTXR2 (NP_477520.2; NP_001139266.1)

Rabbit Polyclonal Anti-Antxr2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Antxr2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG

Goat Anti-ANTXR2 / CMG2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-HEGLKLANEQIQK, from the internal regoin of the protein sequence according to NP_477520.2; NP_001139266.1.

ANTXR2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANTXR2

ANTXR2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 339-488 of human ANTXR2 (NP_477520.2).
Modifications Unmodified