ANTXR2 (121-133) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rabbit |
Immunogen | Synthetic peptide from an internal region of human ANTXR2 (NP_477520.2; NP_001139266.1) |
ANTXR2 (121-133) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rabbit |
Immunogen | Synthetic peptide from an internal region of human ANTXR2 (NP_477520.2; NP_001139266.1) |
Rabbit Polyclonal Anti-Antxr2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Antxr2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG |
Goat Anti-ANTXR2 / CMG2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HEGLKLANEQIQK, from the internal regoin of the protein sequence according to NP_477520.2; NP_001139266.1. |
ANTXR2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANTXR2 |
ANTXR2 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 339-488 of human ANTXR2 (NP_477520.2). |
Modifications | Unmodified |