Antibodies

Jump to Filters
View as table Download
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA326936

USD 374.00

3 Weeks

ANXA1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANXA1
Annexin A1 (ANXA1) (324-337) Goat Polyclonal Antibody
AP22515PU-N

USD 440.00

2 Weeks

Annexin A1 (ANXA1) (324-337) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Equine, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Immunogen Peptide from the C Terminus of the protein sequence according to NP_000691.1
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA308701

USD 415.00

2 Weeks

Rabbit polyclonal antibody to Annexin A1 (annexin A1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of Annexin A1 (Uniprot ID#P04083)
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA590778

USD 409.00

In Stock

Rabbit Polyclonal Annexin A1 Antibody

Applications ELISA, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
Annexin A1 (ANXA1) Mouse Monoclonal Antibody [Clone ID: 2F1]
TA336944

USD 374.00

5 Days

Mouse Monoclonal Annexin A1 Antibody (2F1)

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA313314

USD 345.00

In Stock

Rabbit polyclonal ANXA1 (Ab-21) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human ANXA1 around the phosphorylation site of tyrosine 21 (Q-E-YP-V-Q).
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA341644

USD 310.00

5 Days

Rabbit Polyclonal Anti-ANXA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1. Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
Annexin A1 (ANXA1) (Center) Rabbit Polyclonal Antibody
AP17109PU-N

USD 450.00

2 Weeks

Annexin A1 (ANXA1) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human ANKRD6
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
AP20568PU-N

USD 370.00

2 Weeks

Annexin A1 (ANXA1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Annexin A1 (ANXA1) (N-term) Rabbit Polyclonal Antibody
AP22730PU-N

USD 440.00

2 Weeks

Annexin A1 (ANXA1) (N-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Immunogen ANXA1 antibody was raised against synthetic peptide corresponding to N-terminal of human annexin I
Annexin A1 (ANXA1) (N-term) Rabbit Polyclonal Antibody
AP23249PU-N

USD 330.00

2 Weeks

Annexin A1 (ANXA1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Canine, Human, Monkey
Immunogen Synthetic peptides (KLH-coupled) corresponding to residues within the aminoterminal residues of human annexin A1
Annexin A1 (ANXA1) Goat Polyclonal Antibody
TA305797

USD 375.00

5 Days

Goat Anti-Annexin I Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CQAILDETKGDYEK, from the C Terminus of the protein sequence according to NP_000691.1.
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA354632

USD 355.00

5 Days

Rabbit anti Annexin I Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Annexin A1 (ANXA1) Mouse Monoclonal Antibody [Clone ID: OTI3A8]
CF500967

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANXA1 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA323578

USD 345.00

In Stock

Anti-ANXA1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA323579

USD 345.00

In Stock

Anti-ANXA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Annexin A1 (ANXA1) Mouse Monoclonal Antibody [Clone ID: OTI3A8]
TA500967

USD 379.00

In Stock

Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Annexin A1 (ANXA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]
TA500967AM

USD 420.00

4 Weeks

Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Annexin A1 (ANXA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A8]
TA500967BM

USD 420.00

4 Weeks

Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Annexin A1 (ANXA1) Mouse Monoclonal Antibody [Clone ID: OTI3A8]
TA500967S

USD 159.00

In Stock

Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated