Rabbit Polyclonal Anti-ANXA13 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANXA13 |
Rabbit Polyclonal Anti-ANXA13 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANXA13 |
Rabbit Polyclonal anti-Anxa13 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Anxa13 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KILVSLLQASRDEEDTVDKELAGQDAKDLYDAGEGRWGTDELAFNEVLAK |
Rabbit Polyclonal Anti-ANXA13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA13 antibody: synthetic peptide directed towards the N terminal of human ANXA13. Synthetic peptide located within the following region: KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS |
Rabbit Polyclonal Anti-ANXA13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA13 antibody: synthetic peptide directed towards the N terminal of human ANXA13. Synthetic peptide located within the following region: EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE |
Anxa13 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Anxa13 |
ANXA13 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANXA13 |
ANXA13 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-316 of human ANXA13 (NP_004297.2). |
Modifications | Unmodified |