Germany
Japan
United Kingdom
China
Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein |
Antibodies
View as table Download
ANXA2 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANXA2 |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against Calretinin
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STVHEILCKLSLEGD, from the N Terminus of the protein sequence according to NP_001002858.1; NP_004030.1; NP_001002857.1. |
Rabbit Polyclonal Anti-ANXA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2. Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD |
Anti-ANXA2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
ANXA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ANXA2 |
Annexin A2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-339 of human Annexin A2 (NP_004030.1). |
| Modifications | Unmodified |
Annexin A2 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Annexin A2 |
Active filters
Target Symbol
- ANXA2