Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ANXA7 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ANXA7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-356 amino acids from the Central region of human ANXA7. |
Rabbit Polyclonal Anti-ANXA7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA7 antibody: synthetic peptide directed towards the N terminal of human ANXA7. Synthetic peptide located within the following region: MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP |
Rabbit Polyclonal Anti-ANXA7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA7 antibody: synthetic peptide directed towards the N terminal of human ANXA7. Synthetic peptide located within the following region: GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK |
Carrier-free (BSA/glycerol-free) ANXA7 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-ANXA7 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 232 amino acids of Human Annexin A7 |
ANXA7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 237-466 of human ANXA7 (NP_001147.1). |
| Modifications | Unmodified |
ANXA7 (Annexin VII) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
ANXA7 mouse monoclonal antibody,clone 1C3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
ANXA7 mouse monoclonal antibody,clone 1C3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ANXA7 (Annexin VII) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ANXA7