Antibodies

View as table Download

Rabbit Polyclonal Anti-APEH Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-APEH antibody: synthetic peptide directed towards the N terminal of human APEH. Synthetic peptide located within the following region: VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR

Rabbit anti-APEH Polyclonal Antibody

Applications ELISA, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-APEH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APEH antibody: synthetic peptide directed towards the middle region of human APEH. Synthetic peptide located within the following region: GSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSH

Rabbit Polyclonal Anti-APEH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human APEH

APEH rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human APEH

APEH Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified