Antibodies

View as table Download

Apolipoprotein A II (APOA2) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Human Apo AII

Rabbit Polyclonal Anti-APOA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME

Rabbit polyclonal anti-APOA2 antibody (Center)

Applications WB
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen This APOA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-56 amino acids from the Central region of human APOA2.

Apolipoprotein A2 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified