Antibodies

Jump to Filters
View as table Download
Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
AP22595PU-N

USD 440.00

2 Weeks

Apolipoprotein A II (APOA2) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Human Apo AII
Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
TA335017

USD 375.00

5 Days

Rabbit Polyclonal Anti-APOA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
TA328111

USD 512.00

5 Days

Rabbit polyclonal anti-APOA2 antibody (Center)

Applications WB
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen This APOA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-56 amino acids from the Central region of human APOA2.
Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
TA373584

USD 410.00

3 Weeks

Apolipoprotein A2 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified