Antibodies

View as table Download

Apolipoprotein B (APOB) goat polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
Immunogen ApoLipoprotein Type B was isolated from human plasma by density gradient centrifugation followed by HPLC purification,

Rabbit Polyclonal Anti-APOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOB antibody: synthetic peptide directed towards the middle region of human APOB. Synthetic peptide located within the following region: SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV

Apolipoprotein B (APOB) goat polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Affinity purified Apolipoprotein-B (hLDL)

Goat Anti-APOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TDLHLRYQKDKK, from the internal region of the protein sequence according to NP_000375.2.

Anti-APOB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2158-2177 amino acids of human apolipoprotein B (including Ag(x) antigen)

Anti-APOB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2158-2177 amino acids of human apolipoprotein B (including Ag(x) antigen)

ApoB Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified