Germany
Japan
United Kingdom
China
Apolipoprotein B (APOB) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | ApoLipoprotein Type B was isolated from human plasma by density gradient centrifugation followed by HPLC purification, |
Antibodies
View as table Download
Rabbit Polyclonal Anti-APOB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOB antibody: synthetic peptide directed towards the middle region of human APOB. Synthetic peptide located within the following region: SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV |
Apolipoprotein B (APOB) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Affinity purified Apolipoprotein-B (hLDL) |
Goat Anti-APOB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TDLHLRYQKDKK, from the internal region of the protein sequence according to NP_000375.2. |
Anti-APOB Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2158-2177 amino acids of human apolipoprotein B (including Ag(x) antigen) |
ApoB Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-330 of human ApoB (NP_000375.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- APOB